General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A511ZD24",
        "id": "A0A511ZD24_9BACI",
        "source_organism": {
            "taxId": "582851",
            "scientificName": "Oceanobacillus sojae",
            "fullName": "Oceanobacillus sojae"
        },
        "name": "CCA-adding enzyme",
        "description": [
            "Catalyzes the addition and repair of the essential 3'-terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in the order of C, C, and A to the tRNA nucleotide-73, using CTP and ATP as substrates and producing inorganic pyrophosphate. tRNA 3'-terminal CCA addition is required both for tRNA processing and repair. Also involved in tRNA surveillance by mediating tandem CCA addition to generate a CCACCA at the 3' terminus of unstable tRNAs. While stable tRNAs receive only 3'-terminal CCA, unstable tRNAs are marked with CCACCA and rapidly degraded"
        ],
        "length": 395,
        "sequence": "MLPFVFQKAAEVISIIEKHQYEAYFVGGCVRDYIIDRPIHDVDIATSATPAEIQEIFPKVIPVGLEHGTVIVKHHQESFEVTTYRTDGTYTDHRRPDKVHFVRNIKEDLKRRDFTMNAIAMNVKGEIVDPFEGRKDISQKRIQTVGEAADRFEEDALRIIRALRFSSQLGFSIEEATKEAMGKYKALINKLAVERLTVELEKLCAGIFYTKAVDYIFELELYHYLPIFKDVPLLLKQIEPVSSLAPVFAFVELKSSSITAADCVKAYKCSNQLKQQANILVDAYHRYKQCGIDAWFVYLLPEEQWDFFVYLVKQTDKEIINIQELRNIQKRLSISSKKELCLNGHDLMQWFPERTKGKWIKELLDEIEYQIVTSKLANEKSKIKDWIQWNQPDQD",
        "proteome": "UP000321558",
        "gene": "cca",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016779",
                "name": "nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004810",
                "name": "CCA tRNA nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001680",
                "name": "tRNA 3'-terminal CCA addition",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "32cfc1308e1885dbe81b8f4fcc905da285e7a72e",
        "counters": {
            "domain_architectures": 5423,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "cdd": 1,
                "pfam": 3,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5423
        }
    }
}