GET /api/protein/UniProt/A0A511MHG4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A511MHG4",
        "id": "A0A511MHG4_9NOCA",
        "source_organism": {
            "taxId": "1210091",
            "scientificName": "Nocardia ninae NBRC 108245",
            "fullName": "Nocardia ninae NBRC 108245"
        },
        "name": "ADP-dependent (S)-NAD(P)H-hydrate dehydratase",
        "description": [
            "Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. This allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration",
            "Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration"
        ],
        "length": 482,
        "sequence": "MSTQRGYFTADEVRAAEAELFTRVPDGVPMQRAAHGLATVVAGELRVRTGGVAGRSVTLLVGSGDNGGDALWAGSMLRRRGVAVTAVLLNPDRAHAKGLAALRKAGGRVRDEVGAPDLVIDGIVGISGHGALRPDAAELVAALEVPIVAADLPSGVDPDTGAITGPAVRAAVTVAFGAYKPVHVLAAPHCGRIELVPIGLQLPEPKLAAPAPASIGASWPVPDEHDDKYTQGVTGVCAGSADYPGAAVLCTGAAVLATSGMVRYAGTGSADVLAEFPEVIATQHVSEVGRVQAWVFGPGAGTDADARKRLTEILATDLPVVVDADGLTMLAAEPELVRGRSAPTVLTPHAGEFARLTGAEIGADRVAAARALAEDWRLTVLLKGRATVVATPDAPVLVNEAGASWAATAGAGDVLSGIIGALLAAGHTPAWAAASAARAHSLAANLAAHEGHPEAAPISATPLLHHLRPAIRTLRSLARPEL",
        "proteome": "UP000321424",
        "gene": "nnrD",
        "go_terms": [
            {
                "identifier": "GO:0016836",
                "name": "hydro-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0052855",
                "name": "ADP-dependent NAD(P)H-hydrate dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d3cc4a65e0d282cab6625d9174661852f47cd75",
        "counters": {
            "domain_architectures": 19697,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19697
        }
    }
}