GET /api/protein/UniProt/A0A506U0N1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A506U0N1",
"id": "A0A506U0N1_9HYPH",
"source_organism": {
"taxId": "2590451",
"scientificName": "Martelella alba",
"fullName": "Martelella alba"
},
"name": "Adenine deaminase",
"description": [
"Catalyzes the hydrolytic deamination of adenine to hypoxanthine. Plays an important role in the purine salvage pathway and in nitrogen catabolism"
],
"length": 320,
"sequence": "MPKAELHCHIEGAAPPALAARLADKYGVDLGAYLKDGVYQWHDFTSFVAAYAAIASVFRSEDDFAALAEDYLTELAEAGTIYSELFVSPEQGLSAGLSRDGYMRAVVEGIERARDKTGIECRMVMIGERHMGPEQVEGAALYASAYQGKLLTGFNIAGDERMHRMADFTRAYDIARDAGLKLTVHAGELEGAFSVREALDCLRPDRIGHGVRAIEDASLVKRLADEGVVLEVCPGSNIALSVYPSFTAHPLRRLFDAGVKVTLSSDDPPFFHTSLSLEYQRAETEMGFSVDEIARMTRTAIEAGFVDDATRSVLLARLPA",
"proteome": "UP000318801",
"gene": "FJU08_19110",
"go_terms": [
{
"identifier": "GO:0019239",
"name": "deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000034",
"name": "adenine deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006146",
"name": "adenine catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "56b5c7a7ba82ad9ffaf4cf97d30242d9cc07c569",
"counters": {
"domain_architectures": 34313,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 34313
}
}
}