HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4Z1B2K3",
"id": "A0A4Z1B2K3_9STAP",
"source_organism": {
"taxId": "1611836",
"scientificName": "Staphylococcus pragensis",
"fullName": "Staphylococcus pragensis"
},
"name": "Large ribosomal subunit protein uL14",
"description": [
"Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome"
],
"length": 122,
"sequence": "MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKAVVVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPEVL",
"proteome": "UP000297459",
"gene": "rplN",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bfe0eecd917e299541388c0abf6635e43a3ce085",
"counters": {
"domain_architectures": 48983,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 48983
}
}
}