GET /api/protein/UniProt/A0A4Y8WMJ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4Y8WMJ3",
        "id": "A0A4Y8WMJ3_9PORP",
        "source_organism": {
            "taxId": "28114",
            "scientificName": "Porphyromonas levii",
            "fullName": "Porphyromonas levii"
        },
        "name": "CTP synthase",
        "description": [
            "Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the four ribonucleotide triphosphates"
        ],
        "length": 537,
        "sequence": "MKRDARYIFVTGGVVSSLGKGIVAASLGKLLQSRGYSVTIQKFDPYINVDPGTLNPYEHGECYVAEDGHEADLDLGHYERFLDIRTSKDNNVTSGRIYQNVIQRERKGDFLGKTVQVVPHITDEIKRNVKRLGLTGKYDFVITEIGGTVGDIESLPFLESVRQLKWELEDKCMVVHLTYVPYIKAAGEVKTKPTQHSVKQLQEEGIQPDMLVLRTEMKLDEGILNKVALFCNVPKRAVVQSYDVPSIYEVPLVMQEQDADEVLLRKFGMEVGPKPELKDWCAFLDLKNNAKEEISIGLVGKYVELQDAYKSIDEALQQTAIYNGRKLHLVHLQSENMTDDNIAEMLKGIDGVIVAPGFGQRGTEGKLVALKYCREHNLPTLGICLGMQMMVVEGARNVLGLEGAHSSEIEPNTAYPVIDLMDDQKSVVNLGGTMRLGAYDCHLMAGSKVAQAYGKLDIRERHRHRYEFNSKYEQAFEEAGFALTGKNPDSGLVEVIECPELDWYIGVQFHPEYSSTLIHPHPLFMSFMRAAIKHSEQ",
        "proteome": "UP000297225",
        "gene": "pyrG",
        "go_terms": [
            {
                "identifier": "GO:0003883",
                "name": "CTP synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006221",
                "name": "pyrimidine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006241",
                "name": "CTP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5fd849ee322c87077b670104fc9e7b1197769099",
        "counters": {
            "domain_architectures": 33489,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "pfam": 2,
                "profile": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33489
        }
    }
}