HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4Y5YT78",
"id": "A0A4Y5YT78_9MICO",
"source_organism": {
"taxId": "104336",
"scientificName": "Microbacterium foliorum",
"fullName": "Microbacterium foliorum"
},
"name": "Bifunctional enzyme IspD/IspF",
"description": [
"Bifunctional enzyme that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP) (IspD), and catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP) (IspF)"
],
"length": 405,
"sequence": "MSMLPVPDTAIIVVAAGSGTRLDAGAPKAFVGIDTHSILRHALDGVFAAAPAQVIVVAPAGYEGDAETELRAAAGDRIDLGRIVTGGDTRQESVASGLDALWGDVTRVLVHDAARALTPPEIIDAVAAATDGESGVIPTLPVVDTLKRVDGDAVVAPIDRSQLAAAQTPQGFPRALLEAAYDAATASGIEYTDDAALFAAAGHLVRQIAGSPRGFKITTPADLERARHLLADVQRPVATPAPAPHSTWSGPRVGLGTDVHAFGGDGNLWLAGIEWPGERALSGHSDGDAVAHAMVDALLGAAGLGDIGEHFGTAHPEYAGAHAEVFLARTREILAEAGYAIGNVSVQFKGNRPRFSGRRAEAERVLSAALGGAPVSVTATTTDGLGFTGRGEGIAVTAVAMVHPA",
"proteome": null,
"gene": "ispDF",
"go_terms": [
{
"identifier": "GO:0070567",
"name": "cytidylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008685",
"name": "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016114",
"name": "terpenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050518",
"name": "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "99e1dd050c8ea9c54af300699c83a6473cdf2290",
"counters": {
"domain_architectures": 4608,
"entries": 24,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"hamap": 3,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"prosite": 2,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4608
}
}
}