GET /api/protein/UniProt/A0A4X2KV86/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4X2KV86",
        "id": "A0A4X2KV86_VOMUR",
        "source_organism": {
            "taxId": "29139",
            "scientificName": "Vombatus ursinus",
            "fullName": "Vombatus ursinus (Common wombat)"
        },
        "name": "glutathione-disulfide reductase",
        "description": [
            "Catalyzes the reduction of glutathione disulfide (GSSG) to reduced glutathione (GSH). Constitutes the major mechanism to maintain a high GSH:GSSG ratio in the cytosol"
        ],
        "length": 410,
        "sequence": "MWNTAVHSELIHDQEDYGFQSCDAKFNWRVIKEKRDAYVSRLNTIYQNNLTKSQIDIIRGYATFTSDPEPTVEVNGKKYRAPHILIATGGFPTLPSEDQIPGASLGMTSDGFFELEDLPRRSVIVGAGYIAVEIAGILSALGSRTSLMIRHNRVLRSFDSMISSNCTEELENAGIEVLKYSQVPEVKKASSGLELTVVTVEPGRKPTFSTISDVDCLLWAIGRTPNVRGLNLNKLGVQTDGEGHILVDEFQNTSRQGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKLDSRLDYENIPTVVFSHPPIGTVGLTEDEAISKYGKENVKIYVTAFTPMYHAVTRRKTKCVMKMVCALQEEKVVGIHMQGIGCDEMLQGFAVAVKMGARKADFDNTVAIHPTSSEELVTLR",
        "proteome": "UP000314987",
        "gene": "GSR",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004362",
                "name": "glutathione-disulfide reductase (NADPH) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006749",
                "name": "glutathione metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045454",
                "name": "cell redox homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "786e6e0af388e0b289d71a3e92e80414d4c849c2",
        "counters": {
            "domain_architectures": 105347,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "ncbifam": 2,
                "panther": 1,
                "prints": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 105347
        }
    }
}