HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4X2KV86",
"id": "A0A4X2KV86_VOMUR",
"source_organism": {
"taxId": "29139",
"scientificName": "Vombatus ursinus",
"fullName": "Vombatus ursinus (Common wombat)"
},
"name": "glutathione-disulfide reductase",
"description": [
"Catalyzes the reduction of glutathione disulfide (GSSG) to reduced glutathione (GSH). Constitutes the major mechanism to maintain a high GSH:GSSG ratio in the cytosol"
],
"length": 410,
"sequence": "MWNTAVHSELIHDQEDYGFQSCDAKFNWRVIKEKRDAYVSRLNTIYQNNLTKSQIDIIRGYATFTSDPEPTVEVNGKKYRAPHILIATGGFPTLPSEDQIPGASLGMTSDGFFELEDLPRRSVIVGAGYIAVEIAGILSALGSRTSLMIRHNRVLRSFDSMISSNCTEELENAGIEVLKYSQVPEVKKASSGLELTVVTVEPGRKPTFSTISDVDCLLWAIGRTPNVRGLNLNKLGVQTDGEGHILVDEFQNTSRQGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKLDSRLDYENIPTVVFSHPPIGTVGLTEDEAISKYGKENVKIYVTAFTPMYHAVTRRKTKCVMKMVCALQEEKVVGIHMQGIGCDEMLQGFAVAVKMGARKADFDNTVAIHPTSSEELVTLR",
"proteome": "UP000314987",
"gene": "GSR",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004362",
"name": "glutathione-disulfide reductase (NADPH) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006749",
"name": "glutathione metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045454",
"name": "cell redox homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "786e6e0af388e0b289d71a3e92e80414d4c849c2",
"counters": {
"domain_architectures": 105347,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 105347
}
}
}