General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4X2KSI9",
        "id": "A0A4X2KSI9_VOMUR",
        "source_organism": {
            "taxId": "29139",
            "scientificName": "Vombatus ursinus",
            "fullName": "Vombatus ursinus (Common wombat)"
        },
        "name": "Bifunctional apoptosis regulator",
        "description": [
            "Membrane-bound E3 ubiquitin ligase that plays a role in several processes including apoptosis regulation or reticulum endoplasmic stress. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors. Contributes to the dynamic control of IRE1/ERN1 signaling during ER stress by inducing BAX inhibitor 1/TMBIM6 proteasomal degradation. Promotes the activation of TGF-beta signaling by mediating the 'Lys-63'-linked ubiquitination of TGFBR1 which is critical to activate the pathway. Together with NGFR, negatively regulates NF-kappa-B and JNK-related signaling pathways. Promotes the proteasome-mediated degradation of PNPLA3, a protein involveld in lipid metabolism"
        ],
        "length": 446,
        "sequence": "MEDVQLIAPNVRSTEEEPVPGVSRQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWVSSKKTECPECREKWEGFPKVNILLRDAIEKLFPDAIKLRLEDIQQNSDIVHSLAAFHKYGNDQISVAPNAGRANPQRGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKSVAKWTAEEVIFWLEQLGPWASLYRERFLSERVNGRLLLTLTDEDFSKAPYNIENSSHRKAIIMELERVKTLGVKPPQNLWEYKAVNPGKSLFLLYALKSSPRLSMLYLYLFDYAETFLPFIHTICPVQEKEDIITKFFDFKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLDVHYWTSRFLIVNAMLLSVLELFSFWRIWSRNELKTVPHIMWSHFWKVSTQGLFVAIFWPIIPQFICNCLFYWALYFNPIINIDLVVKEVRRLETQVL",
        "proteome": "UP000314987",
        "gene": "BFAR",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c21cbfe4551580ddff6ac5b414dc153025e6bdde",
        "counters": {
            "domain_architectures": 703,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "pfam": 2,
                "smart": 2,
                "profile": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 703
        }
    }
}