GET /api/protein/UniProt/A0A4X1VMG9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4X1VMG9",
        "id": "A0A4X1VMG9_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "Mitochondria-associated granulocyte macrophage CSF-signaling molecule",
        "description": [
            "Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity"
        ],
        "length": 124,
        "sequence": "AKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHQSAAASNLSGLSLQEAQQILNVSKLSPEEIQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLEEELRIQAQEDRERQQTPGT",
        "proteome": null,
        "gene": "LOC100513346",
        "go_terms": [
            {
                "identifier": "GO:0030150",
                "name": "protein import into mitochondrial matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005744",
                "name": "TIM23 mitochondrial import inner membrane translocase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f3725d9a757d4b54e739feeae5bd9f2ec28b4f6b",
        "counters": {
            "domain_architectures": 4714,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4714
        }
    }
}