GET /api/protein/UniProt/A0A4W6DN80/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4W6DN80",
        "id": "A0A4W6DN80_LATCA",
        "source_organism": {
            "taxId": "8187",
            "scientificName": "Lates calcarifer",
            "fullName": "Lates calcarifer (Barramundi)"
        },
        "name": "Troponin I2, fast skeletal type",
        "description": [
            "Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity"
        ],
        "length": 170,
        "sequence": "MSEKKMTSSRRHHLKSLMLQIAANWIENEKKEIAAAKQAYMAEHCPAPNLGGDQATLMETCKKLHALIDKVDEERYDLQAKVGKADKEIDDLKIKVVDLAGVKKPALKRVRMSADAMLKALLGSKHTVNLDLRANLKQVKKEVKEEPIEAGDWRKNIEDKADRKKMFESS",
        "proteome": "UP000314980",
        "gene": "TNNI2",
        "go_terms": [
            {
                "identifier": "GO:0005861",
                "name": "troponin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e87376e55612704cb38509e8056e1fce9be7d25a",
        "counters": {
            "domain_architectures": 15375,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15375
        }
    }
}