GET /api/protein/UniProt/A0A4W6D315/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4W6D315",
        "id": "A0A4W6D315_LATCA",
        "source_organism": {
            "taxId": "8187",
            "scientificName": "Lates calcarifer",
            "fullName": "Lates calcarifer (Barramundi)"
        },
        "name": "Glucose-6-phosphatase",
        "description": [
            "Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels"
        ],
        "length": 346,
        "sequence": "MDLLHSSGVSSTSYLQTHYSHSQSYFLLVSTATDLHSTFFLLFPVWFHVQQAEAVKLVWVAVVGDWVNLMLKWLLFGERPYWWVQETGYYGNSSQPMIEQFPMTCETGPGSPSGHAMGAAAVCYTMMSSLLATVCVRVSLWMLFGCVQMCVCLSRVFVAAHFPHQVITGVIIGILVAECLSRAQQIFKARLHSYLIISLLLLSLALLLYACLQLVGINLLWSVEKARRWCHQAEWVSMDTSPLASLFRNTGTLLGLGLGLHSPLHSLTNRAAFSKGTDGAIYRFICSSVTLVLLQLFDSAFQPPVYSGALFYLLSFCKSATVPLATVAVVPFCVTAALGYKGEKLL",
        "proteome": "UP000314980",
        "gene": "G6PC1",
        "go_terms": [
            {
                "identifier": "GO:0004346",
                "name": "glucose-6-phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff308a62e727406a341790172e35cf62f6fc2c9c",
        "counters": {
            "domain_architectures": 108244,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 108244
        }
    }
}