GET /api/protein/UniProt/A0A4W2IJX9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4W2IJX9",
"id": "A0A4W2IJX9_BOBOX",
"source_organism": {
"taxId": "30522",
"scientificName": "Bos indicus x Bos taurus",
"fullName": "Bos indicus x Bos taurus (Hybrid cattle)"
},
"name": "Centrosomal protein of 41 kDa",
"description": [
"Required during ciliogenesis for tubulin glutamylation in cilium. Probably acts by participating in the transport of TTLL6, a tubulin polyglutamylase, between the basal body and the cilium"
],
"length": 340,
"sequence": "MSESPHDGCPSKPEPDYRYKKDELFKRLKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEPDAEITAKTNGNGSPGEQSPSPVQFINSEGAGDFSRSTLQSVISGVGELDLDKGLVKKTEPNTKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPPGSARKRSSPKVPPLPAENKWRFTPEDLKKIEYYLEEDQGPADNPSRLSQANASGRDAKVPGTRSGQNLPAGGPASHQNPRSLGSGHLQGKPWK",
"proteome": "UP000314981",
"gene": "CEP41",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d8b07c182f65aef6466cd58366a63f75051d79b8",
"counters": {
"domain_architectures": 88335,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 88335
}
}
}