GET /api/protein/UniProt/A0A4W2FQQ4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4W2FQQ4",
        "id": "A0A4W2FQQ4_BOBOX",
        "source_organism": {
            "taxId": "30522",
            "scientificName": "Bos indicus x Bos taurus",
            "fullName": "Bos indicus x Bos taurus (Hybrid cattle)"
        },
        "name": "Outer dense fiber protein 1",
        "description": [
            "Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail"
        ],
        "length": 262,
        "sequence": "MAALSCLLDSVRRDIKKVDRELRQLRCIDELSARCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYPCCLCDVKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCNPCSPCSPCNPCNPCSPCSPCSPCNPCDPCNPCYPCGSRFSCRKMIL",
        "proteome": null,
        "gene": "ODF1",
        "go_terms": [
            {
                "identifier": "GO:0099513",
                "name": "polymeric cytoskeletal fiber",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a49c7cd006c7b597e6e0f45e18cc046e51a1431",
        "counters": {
            "domain_architectures": 86430,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 86430
        }
    }
}