HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4W2E5T1",
"id": "A0A4W2E5T1_BOBOX",
"source_organism": {
"taxId": "30522",
"scientificName": "Bos indicus x Bos taurus",
"fullName": "Bos indicus x Bos taurus (Hybrid cattle)"
},
"name": "Sidoreflexin",
"description": [
"Amino acid transporter importing serine, an essential substrate of the mitochondrial branch of the one-carbon pathway, into mitochondria. Mitochondrial serine is then converted to glycine and formate, which exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. May also transport other amino acids including alanine and cysteine"
],
"length": 322,
"sequence": "MSGELPPNINIKEPRWDQSTFIGRAKHFFTVTDPRNILLTNEQLEAARKVVHDYRQGIIPSGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPVQVGIVGFCLVFATPLCCALFPQKSSMSVTSLEAELQARIRETYPELRRVYFNKGL",
"proteome": "UP000314981",
"gene": "SFXN1",
"go_terms": [
{
"identifier": "GO:0015075",
"name": "monoatomic ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006811",
"name": "monoatomic ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "38f889100fb890e704dfa07b643183b485b1a666",
"counters": {
"domain_architectures": 9494,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9494
}
}
}