GET /api/protein/UniProt/A0A4W2CCF7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4W2CCF7",
        "id": "A0A4W2CCF7_BOBOX",
        "source_organism": {
            "taxId": "30522",
            "scientificName": "Bos indicus x Bos taurus",
            "fullName": "Bos indicus x Bos taurus (Hybrid cattle)"
        },
        "name": "UDP-glucuronosyltransferase",
        "description": [
            "UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds"
        ],
        "length": 523,
        "sequence": "MGAQRVLLLVIYLPPALLLSEAAKILTISSLGGSHSLLMHRVSQILQDHGHNITMLSNRGRSLASDLEKEEHSFQVISWHSPGDLENEIRKRLDLFVTEALHNRKKSEHFVNLMETLGTRCSYLLRRRDIMDSLKNENFDLIVVDAFDFCSFLIAEKLGKLFVSILSTLVSRLDFGLPSPLSYVPVFQSFLTDHMDFWGRVKNFLMSLVFSVEQWKIHSTFDNTIKEHFQEGSRPVLSHLLKKAELWFVSSDFAFEFARPLFPNTVNVGGLMVKPIKPVPQELENFIAKFGDSGFVLVALGSIVSRYQSQEILKEMNAAFARLPQGVIWKCKPSHWPRDVKLAANVKIMDWLPQNDLLAHSHIRLFVTHGGMNSIMEAIHHGVPMVGIPVFEDQDENLLRVETRKFGVSIQLEQMKAETLALKMKQVMEDKRYKSAAEAASIIRRSQPLTPAQRLVGWIDHILQTGGAAHLKPHAFQQPWYEQYLLDVLLFLLVVTLGTAWLCGKLLGLVARWLCGARKLKKA",
        "proteome": "UP000314981",
        "gene": "LOC113879126",
        "go_terms": [
            {
                "identifier": "GO:0008194",
                "name": "UDP-glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "781f331c11f55b381926aa2b09b4b07d5b4d0620",
        "counters": {
            "domain_architectures": 97521,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 97521
        }
    }
}