GET /api/protein/UniProt/A0A4U1FNH1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4U1FNH1",
        "id": "A0A4U1FNH1_MONMO",
        "source_organism": {
            "taxId": "40151",
            "scientificName": "Monodon monoceros",
            "fullName": "Monodon monoceros (Narwhal)"
        },
        "name": "Core histone macro-H2A",
        "description": [
            "Variant histone H2A which replaces conventional H2A in a subset of nucleosomes"
        ],
        "length": 372,
        "sequence": "MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK",
        "proteome": null,
        "gene": "EI555_008914",
        "go_terms": [
            {
                "identifier": "GO:0046982",
                "name": "protein heterodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030527",
                "name": "structural constituent of chromatin",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000786",
                "name": "nucleosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006334",
                "name": "nucleosome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a273adac5b0b38a5048807a5f188b724ed253a54",
        "counters": {
            "domain_architectures": 2208,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "pfam": 3,
                "ssf": 2,
                "cdd": 2,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2208
        }
    }
}