General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4U1F582",
        "id": "A0A4U1F582_MONMO",
        "source_organism": {
            "taxId": "40151",
            "scientificName": "Monodon monoceros",
            "fullName": "Monodon monoceros (Narwhal)"
        },
        "name": "Sodium-coupled neutral amino acid transporter 7",
        "description": [
            "Symporter that selectively cotransports sodium ions and amino acids, such as L-glutamine and L-asparagine from the lysosome into the cytoplasm and may participates in mTORC1 activation. The transport activity requires an acidic lysosomal lumen"
        ],
        "length": 524,
        "sequence": "MAQVSINSDLGEWGLSTDSGERARLLQSPSVDIAPKSEGEAPPGGLGRGTTSTLGAIFIVVNACLGAGLLNFPAAFSTAGGVAAGITLQMAMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIATYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGAGGSPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWPDKEMTPADILNRPASWIAVFNAMPTICFGFQCHVSSVPVFNSMRRPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGMPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLSEMEEVKPASWWAMVSYGVLLVTLGAFIFGQTTANAIFSFRTTLSPASFPSTGGMTSGHPFPGTVLGAMNGRRRSRVTEEPSPLFHLSISPCLEATGEESRGRC",
        "proteome": null,
        "gene": "EI555_013461",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "563bf97a90fdce69b83f48705e7686854a329061",
        "counters": {
            "domain_architectures": 91119,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 91119
        }
    }
}