HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4R8ZTI7",
"id": "A0A4R8ZTI7_9MICO",
"source_organism": {
"taxId": "1259150",
"scientificName": "Cryobacterium frigoriphilum",
"fullName": "Cryobacterium frigoriphilum"
},
"name": "Pyridoxal 5'-phosphate synthase subunit PdxT",
"description": [
"Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is channeled to the active site of PdxS"
],
"length": 223,
"sequence": "MPDSVLVDLPAPAVPGAVTESARQGDAPIGVLALQGDFREHADVLRALGAEVVLVRRPEELARVGGLVIPGGESSVMDKLARMFGLFEPLRAAVQDGLPVYGTCAGLIMLADTVLDGIAGQQSIGGLDIIVRRNAFGSQAASFETDLQVAVLSGAPMHAAFIRAPVVERVGPAATALARLADGRCVAVEQGNLLGTSFHPEITGDYRFHEYFLRRVAAAALRR",
"proteome": "UP000297447",
"gene": "pdxT",
"go_terms": [
{
"identifier": "GO:0004359",
"name": "glutaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042819",
"name": "vitamin B6 biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042823",
"name": "pyridoxal phosphate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d9ee68446c1df6c0159dbd7c94d6823ab2b3a72d",
"counters": {
"domain_architectures": 10917,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10917
}
}
}