GET /api/protein/UniProt/A0A4Q0M2W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4Q0M2W1",
"id": "A0A4Q0M2W1_9SPHI",
"source_organism": {
"taxId": "699437",
"scientificName": "Arcticibacter tournemirensis",
"fullName": "Arcticibacter tournemirensis"
},
"name": "Peptidyl-tRNA hydrolase",
"description": [
"Catalyzes the release of premature peptidyl moieties from peptidyl-tRNA molecules trapped in stalled 50S ribosomal subunits, and thus maintains levels of free tRNAs and 50S ribosomes",
"Hydrolyzes ribosome-free peptidyl-tRNAs (with 1 or more amino acids incorporated), which drop off the ribosome during protein synthesis, or as a result of ribosome stalling"
],
"length": 186,
"sequence": "MKYLVVGLGNIGPEYADTRHNIGFMIADEMAKEAGVTFSNLRLAYYTELSHKGRQIHLIKPTTFMNLSGKAVNYWMHELKIPRENILVLVDDLAIPFGSIRLKPKGGNAGHNGLKSIEALVGGQDYPRLRFGIGDNFSRGRQIDYVLSGFDKEEQLELPALIERSIEIIKSFVAVGTELTMTRYNK",
"proteome": null,
"gene": "pth",
"go_terms": [
{
"identifier": "GO:0004045",
"name": "peptidyl-tRNA hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0acd99499c4bfe704cf6014f6a6b377ddb2d2159",
"counters": {
"domain_architectures": 31239,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 31239
}
}
}