HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4P8F3R0",
"id": "A0A4P8F3R0_9FABA",
"source_organism": {
"taxId": "70937",
"scientificName": "Medicago biflora",
"fullName": "Medicago biflora"
},
"name": "ATP-dependent Clp protease proteolytic subunit",
"description": [
"Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins"
],
"length": 197,
"sequence": "MPIGVPKVPFILPGDDEASWIDLYNRLFQERLLFLGQEVNSEISNQLVGLMVYLSLEDKNKDLYMFINSPGGEVISGMAIFDTMQFVEAEVQTVCVGLAASMGSLLLVGGEITKRLAFPHARVMIHQPATSLYEGQAGDCMLEANELLKMRKTMTNIYAQRTGKPSWQIHKDMERDLYMSAEEAQAHGIIDTVADSL",
"proteome": null,
"gene": "clpP",
"go_terms": [
{
"identifier": "GO:0004176",
"name": "ATP-dependent peptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8b36e1ef7ed4f1caec784c71a0c390b681925f43",
"counters": {
"domain_architectures": 75281,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 75281
}
}
}