GET /api/protein/UniProt/A0A4P8D7I1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4P8D7I1",
"id": "A0A4P8D7I1_ADEB4",
"source_organism": {
"taxId": "70333",
"scientificName": "Bovine adenovirus 4",
"fullName": "Bovine adenovirus 4 (BAdV-4)"
},
"name": "Hexon protein",
"description": [
"Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus"
],
"length": 95,
"sequence": "LVQFITATQSFFNLGEKFRDPFVAPTSGVTTDRSQKLQLRIVPIQVEDNENFFKARFTLNVGDNRIADLGSAFFDIEGFIDRGPSFKPYGGTAYN",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "90df2992dcf10c52596bafa5a0db13cafcdc9168",
"counters": {
"domain_architectures": 6126,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6126
}
}
}