GET /api/protein/UniProt/A0A4P8D7I1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4P8D7I1",
        "id": "A0A4P8D7I1_ADEB4",
        "source_organism": {
            "taxId": "70333",
            "scientificName": "Bovine adenovirus 4",
            "fullName": "Bovine adenovirus 4 (BAdV-4)"
        },
        "name": "Hexon protein",
        "description": [
            "Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus"
        ],
        "length": 95,
        "sequence": "LVQFITATQSFFNLGEKFRDPFVAPTSGVTTDRSQKLQLRIVPIQVEDNENFFKARFTLNVGDNRIADLGSAFFDIEGFIDRGPSFKPYGGTAYN",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "90df2992dcf10c52596bafa5a0db13cafcdc9168",
        "counters": {
            "domain_architectures": 6126,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6126
        }
    }
}