General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4P7XDB5",
        "id": "A0A4P7XDB5_9ALTE",
        "source_organism": {
            "taxId": "2259620",
            "scientificName": "Hydrocarboniclastica marina",
            "fullName": "Hydrocarboniclastica marina"
        },
        "name": "Threonylcarbamoyl-AMP synthase",
        "description": [
            "Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, HCO(3)(-)/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of diphosphate"
        ],
        "length": 190,
        "sequence": "MPNPTLTWHARRASMALKAGDVIAYPTEAVWGLGCDPANETAMKRLLALKQRPKEKGVILIAADLAQVAHLLAPLPDELRAKAESLWPGFVTCILPDLERQVPDWIRGRHDAVAVRVSRHPSVVALCRAFGGPIVSTSCNPSGRPPATTAFAARRYFNQRVQTFMVGHPDQQTGPSPILELSSGRYLRGR",
        "proteome": "UP000298049",
        "gene": "tsaC",
        "go_terms": [
            {
                "identifier": "GO:0003725",
                "name": "double-stranded RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002949",
                "name": "tRNA threonylcarbamoyladenosine modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd062f70d155d26836135770b3359d66636068af",
        "counters": {
            "domain_architectures": 32487,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32487
        }
    }
}