GET /api/protein/UniProt/A0A4P6YS35/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4P6YS35",
"id": "A0A4P6YS35_9LACO",
"source_organism": {
"taxId": "2506420",
"scientificName": "Periweissella cryptocerci",
"fullName": "Periweissella cryptocerci"
},
"name": "Holliday junction resolvase RecU",
"description": [
"Endonuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves mobile four-strand junctions by introducing symmetrical nicks in paired strands. Promotes annealing of linear ssDNA with homologous dsDNA. Required for DNA repair, homologous recombination and chromosome segregation"
],
"length": 203,
"sequence": "MIHYPNGSSFQQGKLATKKGAVKPVTNYGKRGMTLEEELNQANQYYQTKGLAVIHKKPTPVKIVNVNYPARSAAKITEAYFSQASTTDYNGIYRGHYVDFDAKETKNKTSIPLDNFHEHQIAHLKAITEQGGIGFVVIRFVVQDEVFVYPANRLIAYWQNKATGGRKSIPYAEIHDHGFRVPTQLNPTVPYLAAVDQLIAQLP",
"proteome": "UP000292886",
"gene": "recU",
"go_terms": [
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "aaf3d365e37f4745c39f66c8e11fe16a400f9c9a",
"counters": {
"domain_architectures": 4236,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4236
}
}
}