HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4P6YHR8",
"id": "A0A4P6YHR8_9FLAO",
"source_organism": {
"taxId": "2547394",
"scientificName": "Flavobacterium nackdongense",
"fullName": "Flavobacterium nackdongense"
},
"name": "Methionyl-tRNA formyltransferase",
"description": [
"Attaches a formyl group to the free amino group of methionyl-tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and preventing the misappropriation of this tRNA by the elongation apparatus"
],
"length": 315,
"sequence": "MEKLRIVFMGTPEFAVGILETIIKHNYNVVGVITAADKPAGRGQKLKFSAVKEYALTNNLNLLQPTNLKDPNFLSELEALQANLQIVVAFRMLPEVVWKMPKLGTFNLHASLLPNYRGAAPINWAIINGDTKTGVTTFFIDDKIDTGAMILSAETEIDPAENAGQLHDRLMLLGSDTVLDTLVIIEKGTVSTTIQEENQEIKTAYKLNKDNCKIDWSKSTTEIYNLIRGLSPYPSAWCFFQDKNEEWNVKIHEAKMILENHNYAAGSLICSKKEMKIAVNDGYIQPISLQFPGKKKMNVAELLNGMTFSEGAMVV",
"proteome": "UP000291124",
"gene": "fmt",
"go_terms": [
{
"identifier": "GO:0004479",
"name": "methionyl-tRNA formyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071951",
"name": "conversion of methionyl-tRNA to N-formyl-methionyl-tRNA",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "263553189fd17f2554dea1d9646cd1ac999dfb46",
"counters": {
"domain_architectures": 32658,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"ssf": 2,
"cathgene3d": 1,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32658
}
}
}