GET /api/protein/UniProt/A0A4J2FIY8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A4J2FIY8",
        "id": "A0A4J2FIY8_STREE",
        "source_organism": {
            "taxId": "1313",
            "scientificName": "Streptococcus pneumoniae",
            "fullName": "Streptococcus pneumoniae"
        },
        "name": "tRNA N6-adenosine threonylcarbamoyltransferase",
        "description": [
            "Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, together with TsaE and TsaB. TsaD likely plays a direct catalytic role in this reaction"
        ],
        "length": 336,
        "sequence": "MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGVVPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWAHGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDAVGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINLHHNAEQKGESLSTEDLCASFQAAVLDILMAKTKKALEKYPVKTLVVAGGVAANKGLRERLAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDTME",
        "proteome": null,
        "gene": "gcp",
        "go_terms": [
            {
                "identifier": "GO:0002949",
                "name": "tRNA threonylcarbamoyladenosine modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b9abc2a1639562e73a52cbc6da89a4b5eb7adec",
        "counters": {
            "domain_architectures": 61776,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 61776
        }
    }
}