GET /api/protein/UniProt/A0A495WDW5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A495WDW5",
        "id": "A0A495WDW5_9BACT",
        "source_organism": {
            "taxId": "1349822",
            "scientificName": "Coprobacter fastidiosus NSB1 = JCM 33896",
            "fullName": "Coprobacter fastidiosus NSB1 = JCM 33896"
        },
        "name": "Tyrosine recombinase XerC",
        "description": [
            "Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC-XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids"
        ],
        "length": 303,
        "sequence": "MILTERDLMKKYLSYLKLERGLSQNTVEGYRNDVYKLLLYIGTENLTREILQKVDIQQFICGLQDIGIHPRSQARILSGLKSFYKFLCLEDYISVNPVESIEGPKIGLHLPEVLSVEEVNRMVDSFDMSLPESQRNKAIIEVLYGCGLRVSELINLKMSRIYEKEEFIIVEGKGDKQRLVPISRIALHEIEKYKKDRMLLNVKKGDEDILFLNRRGGRLSRVMIFYVIRNQCEICGIHKKISPHTLRHSFATHLLEGGANLRAIQQMLGHESITTTEIYVHLDKEFIKSEILNHHPRNMKFRT",
        "proteome": "UP000269493",
        "gene": "xerC",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015074",
                "name": "DNA integration",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d96699411a9437a74cc8bde6d32395a02dee6a42",
        "counters": {
            "domain_architectures": 58265,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 58265
        }
    }
}