HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A495WDW5",
"id": "A0A495WDW5_9BACT",
"source_organism": {
"taxId": "1349822",
"scientificName": "Coprobacter fastidiosus NSB1 = JCM 33896",
"fullName": "Coprobacter fastidiosus NSB1 = JCM 33896"
},
"name": "Tyrosine recombinase XerC",
"description": [
"Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC-XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids"
],
"length": 303,
"sequence": "MILTERDLMKKYLSYLKLERGLSQNTVEGYRNDVYKLLLYIGTENLTREILQKVDIQQFICGLQDIGIHPRSQARILSGLKSFYKFLCLEDYISVNPVESIEGPKIGLHLPEVLSVEEVNRMVDSFDMSLPESQRNKAIIEVLYGCGLRVSELINLKMSRIYEKEEFIIVEGKGDKQRLVPISRIALHEIEKYKKDRMLLNVKKGDEDILFLNRRGGRLSRVMIFYVIRNQCEICGIHKKISPHTLRHSFATHLLEGGANLRAIQQMLGHESITTTEIYVHLDKEFIKSEILNHHPRNMKFRT",
"proteome": "UP000269493",
"gene": "xerC",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015074",
"name": "DNA integration",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d96699411a9437a74cc8bde6d32395a02dee6a42",
"counters": {
"domain_architectures": 58265,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"ssf": 1,
"cathgene3d": 2,
"pfam": 2,
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 58265
}
}
}