HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A495IBD5",
"id": "A0A495IBD5_9MICO",
"source_organism": {
"taxId": "386892",
"scientificName": "Frondihabitans australicus",
"fullName": "Frondihabitans australicus"
},
"name": "GTP 3',8-cyclase",
"description": [
"Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate"
],
"length": 335,
"sequence": "MITLPAMGLDDRHGRTAVDLRVSLTERCNLRCTYCMPAAGLPVTPDESIMSADEIVRLVELAVRSLGVRKVRFTGGEPLLRRDLVDVVARCSGLTEISLTTNAIGLATRAEALRAAGLERVNVSLDTVDPEAFALVTRRPFLSRVIEGIRAAQDAGLGVKVNAVLLRGVNDALAVDLLRWCLERDIELRFIEQMPLDPDHVWKREEMITASEIRALLGTAFVLETARGPRDGAPAERYVVRAHSGEILGSIGIIASITESFCGDCTRTRLTADGHVRTCLFSDDETDLLTALRAGATDGELARLWRDAMLKKPRDHGSDDVDILPTLRGMSAIGG",
"proteome": "UP000280008",
"gene": "moaA",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006777",
"name": "Mo-molybdopterin cofactor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9bae3ee1a5f3142cd02f57372aa2ae7310271f8b",
"counters": {
"domain_architectures": 24800,
"entries": 25,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"pfam": 2,
"cdd": 2,
"panther": 1,
"sfld": 4,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24800
}
}
}