General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A482AU60",
        "id": "WTF23_SCHKA",
        "source_organism": {
            "taxId": "204045",
            "scientificName": "Schizosaccharomyces kambucha",
            "fullName": "Schizosaccharomyces kambucha (Fission yeast)"
        },
        "name": "Meiotic drive suppressor wtf23",
        "description": [
            "Acts as a suppressor component of the dual wtf meiotic drive system, and can suppress but not confer meiotic drive by compatible poisons (PubMed:32032353). Wtf meiotic drive systems promote unequal transmission of alleles from the parental zygote to progeny spores by encoding a poison and an antidote from the same locus; the poison is trans-acting and forms toxic aggregates in all spores within an ascus, wherease the antidote is spore-specific and targets aggregates for degradation by the vacuole (By similarity). Meiotic drive by wtf systems therefore lead to poisoning of all progeny that do not inherit the dual poison/antidote allele, or express a compatible antidote (By similarity)"
        ],
        "length": 336,
        "sequence": "MKNNYTSLKSPIDEEDELKTGHEIDLEKGLLPEYDSEEEGALPPYSDHARVSNPPNTHRENHSSGTTDDSSPFLIKLLISFTPIVLLNALAVWYLKYKDAFFKNYGAAEWTLFGFWCLVCTLVLIILTYFYETWTKAVKVTVIFLAQCIKVTAVFLAQCVKGLFNIRREMMIIIWILWLIICCILFGCVKDGRLNFNKALICSTCTISAVLFLIVSSVCIPIWTLWRALSGMLQVLGIHGIIAVLVNGSMSLFGKHFGWRGYEIEGFVLFFTSNALFLYEMERPGVLKRMRNTTGNVIGYICGGIEDAFRRIKNAFRGANDNNNIPLGEMDVEGEV",
        "proteome": null,
        "gene": "wtf23",
        "go_terms": [
            {
                "identifier": "GO:0110134",
                "name": "meiotic drive",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9248a17bf28971939a5b1525f1771aee2dd0b6be",
        "counters": {
            "domain_architectures": 113,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 113
        }
    }
}