GET /api/protein/UniProt/A0A455ALT6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A455ALT6",
        "id": "A0A455ALT6_PHYMC",
        "source_organism": {
            "taxId": "9755",
            "scientificName": "Physeter macrocephalus",
            "fullName": "Physeter macrocephalus (Sperm whale)"
        },
        "name": "Probable thioesterase PNKD",
        "description": [
            "Probable thioesterase that may play a role in cellular detoxification processes; it likely acts on a yet-unknown alpha-hydroxythioester substrate. In vitro, it is able to catalyze the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid at very low rate, though this reaction is not physiologically relevant in vivo"
        ],
        "length": 327,
        "sequence": "MKSGTGLRAWMQGGVRAQRKGYSLYTRTWLGYLFYRQQLRRARNRYPKGHSRTQPRLFNGVKVLPIPVLSDNYSYLVIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGNRDLSRRHQDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIQALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVLEPENLARERKMQWVQRQRMERRSTCPSTLGEERSYNPFLRTHCLVLQEALGPGPNPTGDNGYSRAQLLEKLRQLKDLHKSK",
        "proteome": "UP000248484",
        "gene": "LOC102993449",
        "go_terms": [
            {
                "identifier": "GO:0004416",
                "name": "hydroxyacylglutathione hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051596",
                "name": "methylglyoxal catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "340d39f7999d548fe9fd39933b8ee6e301219add",
        "counters": {
            "domain_architectures": 16886,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16886
        }
    }
}