GET /api/protein/UniProt/A0A455ALT6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A455ALT6",
"id": "A0A455ALT6_PHYMC",
"source_organism": {
"taxId": "9755",
"scientificName": "Physeter macrocephalus",
"fullName": "Physeter macrocephalus (Sperm whale)"
},
"name": "Probable thioesterase PNKD",
"description": [
"Probable thioesterase that may play a role in cellular detoxification processes; it likely acts on a yet-unknown alpha-hydroxythioester substrate. In vitro, it is able to catalyze the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid at very low rate, though this reaction is not physiologically relevant in vivo"
],
"length": 327,
"sequence": "MKSGTGLRAWMQGGVRAQRKGYSLYTRTWLGYLFYRQQLRRARNRYPKGHSRTQPRLFNGVKVLPIPVLSDNYSYLVIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGNRDLSRRHQDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIQALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVLEPENLARERKMQWVQRQRMERRSTCPSTLGEERSYNPFLRTHCLVLQEALGPGPNPTGDNGYSRAQLLEKLRQLKDLHKSK",
"proteome": "UP000248484",
"gene": "LOC102993449",
"go_terms": [
{
"identifier": "GO:0004416",
"name": "hydroxyacylglutathione hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051596",
"name": "methylglyoxal catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "340d39f7999d548fe9fd39933b8ee6e301219add",
"counters": {
"domain_architectures": 16886,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"pfam": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16886
}
}
}