HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A452ZJQ0",
"id": "A0A452ZJQ0_AEGTS",
"source_organism": {
"taxId": "200361",
"scientificName": "Aegilops tauschii subsp. strangulata",
"fullName": "Aegilops tauschii subsp. strangulata (Goatgrass)"
},
"name": "Auxin response factor",
"description": [
"Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs)"
],
"length": 258,
"sequence": "MRRRTRCTRASRCWRTPRCSDKTSVSLHPKRGRTRWPVVTERRSPVCLTCSARPSLPPIRARMEVSLFLAGQPRTVSHLWTTSRSGLLKSSLPRTCMAHSGGFAIFIEGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRAVQLRNEALFRAVNSNESKLHTLSAVASSLENRSIFHVCFDPRSGASEFIVPYWRFSKSLNHPFSIGMRFKDSNDSDDANERSTGLISGISEVDPIRWPGSKWRCLQ",
"proteome": "UP000015105",
"gene": null,
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009725",
"name": "response to hormone",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "91b20c412a551e06d7e4852982fafb19c8b66758",
"counters": {
"domain_architectures": 6226,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"profile": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6226
}
}
}