GET /api/protein/UniProt/A0A452TW61/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A452TW61",
"id": "A0A452TW61_URSMA",
"source_organism": {
"taxId": "29073",
"scientificName": "Ursus maritimus",
"fullName": "Ursus maritimus (Polar bear)"
},
"name": "Esterase OVCA2",
"description": [
"Exhibits ester hydrolase activity with a strong preference for long-chain alkyl ester substrates and high selectivity against a variety of short, branched, and substituted esters. Is able to hydrolyze ester bonds within a wide range of p-nitrophenyl derivatives (C2-C14) in vitro, with a strong preference toward substrates of >8 carbons"
],
"length": 227,
"sequence": "MAAQHPLRVLALAGFRQSERGFREKSGALRKALRGRAELVCLSGPHLVADAAGPEDAGPDSEPCLPEEQPRGWWFSEEEADVFDALSQPTACRGLEEALESVAQALKKLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFIILISGFCPRGLGLKEPILQSPLSLPSLHVFGDTDCVIPFQESMQLASRFIGAITLTHCGGHFIPAAAAQRQAYLKFLDQFAG",
"proteome": null,
"gene": "OVCA2",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2efb0fae7d9869eeeabf9dd5447d5d24ed070a34",
"counters": {
"domain_architectures": 12299,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12299
}
}
}