GET /api/protein/UniProt/A0A452FJM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A452FJM8",
        "id": "A0A452FJM8_CAPHI",
        "source_organism": {
            "taxId": "9925",
            "scientificName": "Capra hircus",
            "fullName": "Capra hircus (Goat)"
        },
        "name": "Epithelial sodium channel subunit beta",
        "description": [
            "This is one of the three pore-forming subunits of the heterotrimeric epithelial sodium channel (ENaC), a critical regulator of sodium balance and fluid homeostasis. ENaC operates in epithelial tissues, where it mediates the electrodiffusion of sodium ions from extracellular fluid through the apical membrane of cells, with water following osmotically. It plays a key role in maintaining sodium homeostasis through electrogenic sodium reabsorption in the kidneys. Additionally, ENaC is essential for airway surface liquid homeostasis, which is crucial for proper mucus clearance"
        ],
        "length": 636,
        "sequence": "MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFTSLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALMEAVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPAPGRPCSAHRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMGYPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKKKYCNNQEFPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPRLLPPVSPKDCDWIFHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAQSARYDGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQNPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI",
        "proteome": "UP000291000",
        "gene": "SCNN1B",
        "go_terms": [
            {
                "identifier": "GO:0005272",
                "name": "sodium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015280",
                "name": "ligand-gated sodium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "35aa8b3fca15bf8fdbd42d12380031325608b3e4",
        "counters": {
            "domain_architectures": 25165,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25165
        }
    }
}