GET /api/protein/UniProt/A0A452EMM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A452EMM3",
        "id": "A0A452EMM3_CAPHI",
        "source_organism": {
            "taxId": "9925",
            "scientificName": "Capra hircus",
            "fullName": "Capra hircus (Goat)"
        },
        "name": "Autophagy-related protein 13",
        "description": [
            "Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation"
        ],
        "length": 475,
        "sequence": "METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYAVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGDVQLNGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRHFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTTGEDTGVTCPSVEDSQEVCATSFSTSPPSQLMVPGKEGGVPLGPNQPAHGAQADQERLATYTPSDGAHCAATPSSSEDAETVSNGSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETTSPLQGSLHSDGSSGGSSGHTQDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSLDIGAQSMAEDLDSLPEKLNVREFDAFVETLQ",
        "proteome": "UP000291000",
        "gene": "ATG13",
        "go_terms": [
            {
                "identifier": "GO:0000045",
                "name": "autophagosome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}