GET /api/protein/UniProt/A0A452EM51/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A452EM51",
"id": "A0A452EM51_CAPHI",
"source_organism": {
"taxId": "9925",
"scientificName": "Capra hircus",
"fullName": "Capra hircus (Goat)"
},
"name": "Sulfiredoxin",
"description": [
"Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase"
],
"length": 136,
"sequence": "MGLRAGGALGRAGAGRGAPEGPGPSGGAQGGSIHSGCITAVHNVPLSVLIRPLPSVLDQAKVQSLVDTIRNPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ",
"proteome": "UP000291000",
"gene": "SRXN1",
"go_terms": [
{
"identifier": "GO:0032542",
"name": "sulfiredoxin activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3efd499c5fb539b9601148174461bdae73932162",
"counters": {
"domain_architectures": 18223,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"smart": 1,
"panther": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 18223
}
}
}