HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A449B0T9",
"id": "A0A449B0T9_9BACT",
"source_organism": {
"taxId": "171281",
"scientificName": "Mycoplasmopsis citelli",
"fullName": "Mycoplasmopsis citelli"
},
"name": "DNA primase",
"description": [
"RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication"
],
"length": 634,
"sequence": "MKNISSDTIDLIIRSSNIVNVISQFIPLTKKGNNYVGVCPFHADTSPSLTVSESKNIYKCFSCGHSGNVIHFVKEFKKIPYMQALEFLAHEANLPINFEQFKKVEQVSRDPQKQKIYDLLDIANSFFKLNVTNELAQKFLDLRKINHSEIIQKFDLGFAPLTNYAEILKTNNLYSDLDLNKVGLINDDLNLIFKNRVTFGIKNQYGEIVGFSGRSLNNDKNYAKYLNSPESQLFKKSQILYNFHNAKETALEKRQVIIVEGFMDVIALDQAGAHNTIALMGTALTKDHLRLLKDLKIILFLDNDNAGQSATYKSLLKLIENRFDVEVVINDFNKDPDEIFHAHGKEVLLDILENSRKKGEHIVYENLKKQYRISEISFDVNSVNFDLFKQNLTTLFARSSANTQKIIQERFKKEFNIQIPLYNNDSFIQNTNIQDHVNIKEPKKNSFSLEKSIIYGNVKMEVLLACLVNYHLRDLINHDVNLYNQRQINKVLNKFSIFANFMYFQNDNEPNLEQTFKEILALNLNYQLNDVSNQEDIKEQFINKIKEQIVFFYRNLNPEEVTKEIKEYLNTHQESINSISPETFSHNFYVKMLTKKLELKLSKELTNLVKRNSNNGNVPAFILDFLTKIKASQK",
"proteome": "UP000290985",
"gene": "dnaG",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006269",
"name": "DNA replication, synthesis of primer",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "f39367874c120ad687ee5c10aba5b7094828ed44",
"counters": {
"domain_architectures": 2248,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 3,
"pfam": 3,
"smart": 2,
"cdd": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2248
}
}
}