General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A437APK5",
        "id": "A0A437APK5_9MICR",
        "source_organism": {
            "taxId": "291195",
            "scientificName": "Tubulinosema ratisbonensis",
            "fullName": "Tubulinosema ratisbonensis"
        },
        "name": "DNA 3'-5' helicase",
        "description": [
            "ATP-dependent 3'-5' DNA helicase/translocase; binds dsDNA rather than ssDNA, unzipping it in a translocase rather than classical helicase activity. Component of the general transcription and DNA repair factor IIH (TFIIH) core complex. When complexed to CDK-activating kinase (CAK), involved in RNA transcription by RNA polymerase II. Also involved in transcription-coupled nucleotide excision repair (NER) of damaged DNA. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. The ATPase activity of XPB/SSL2, but not its helicase activity, is required for DNA opening. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. The ATP-dependent helicase activity of XPB/SSL2 is required for promoter opening and promoter escape"
        ],
        "length": 672,
        "sequence": "MSDTLIPKKARQHTFTKENLILKPDHSSKPLFTNYDSTIILETFSRNAKXATDFLIAIAEPITRPASIHEYRITPYSLYAAVSVGLTTEDILQTLDSFSKNYLPKGLTSFIKECTLSYGKVRLLIKGGNFYIESEKESIIKHLKNDSVIKKCLKLVSNENIPENSEEEEILNKIELQNEKIELIKKRCIELXYPLLEEYDFKNDTSKNLKIDLKDSVQIRTYQEVSLNKMFGNSRARSGIIVLPCGSGKTLVGITAICTIKKPTIIFCSSAVSVEQWKQQILMFTNMKDNVCRFTSDKKEMFNEEGILITTYTMLAFSGKRSHEAKKVMDWLSNKEWGLMVLDEVHVVPAMMFRKVISLINHKCKLGLTATLVREDDKIEDLNFLIGPKLYEADWQDLSAKGHIANVECVEIICEMTAEFYREYLRQPKRRRVLSIMNPXKFQICDFLIKKHESLGEKIIVFSDNVLALKTYALKLNKPFIYGPTSQTERMTILKQFQNNPKINTIFLSKVGDTSIDLPEASCLIQISSHFGSRRQEAQRLGRVLRAKRRHDPGFXVFFYSLVSSDTEEIYYSTKRQQFLIDQGYSFRTVLSVEGFDKADQKIFSTKSEQKELLTSVLLVSEQDLLSEESDDFDRIESSKKKASSHSGGEGMAYVEKNKERHILFRKQDKKK",
        "proteome": "UP000282876",
        "gene": "TUBRATIS_003600",
        "go_terms": [
            {
                "identifier": "GO:0003678",
                "name": "DNA helicase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006289",
                "name": "nucleotide-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006367",
                "name": "transcription initiation at RNA polymerase II promoter",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "487df75ccf86f62b8c93874bb22f9740938e72c3",
        "counters": {
            "domain_architectures": 9006,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 2,
                "smart": 2,
                "profile": 2,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9006
        }
    }
}