GET /api/protein/UniProt/A0A426FK17/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A426FK17",
"id": "A0A426FK17_BIBTR",
"source_organism": {
"taxId": "47735",
"scientificName": "Bibersteinia trehalosi",
"fullName": "Bibersteinia trehalosi"
},
"name": "Pyridoxal kinase PdxY",
"description": [
"Pyridoxal kinase involved in the salvage pathway of pyridoxal 5'-phosphate (PLP). Catalyzes the phosphorylation of pyridoxal to PLP"
],
"length": 287,
"sequence": "MKNVLSIQSHVVYGYAGNKAAVFPMQLLGVDTWALNTVQFSNHTQYGKWKGMVIPKEQIGEIAQGIAEIEALHECDAILSGYIGAAEQGAEILAAVAKIKALNPNAIYFCDPVMGHPDKGCIVAPGVAEFLRDEAMAKADIIAPNLVELRELTGLPVLDFDGAIEAIRTILGKGVKKVLVKHLSRVGKDPSQFEMLLATQEGIWHISRPLHEFKAKDPVGVGDLTSGIFLANLLNGKSDVEAFEHTANAVNDVMSVTQQSGKYELQIIQARELIVHPQSRYQAVKIG",
"proteome": null,
"gene": "pdxY",
"go_terms": [
{
"identifier": "GO:0008478",
"name": "pyridoxal kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009443",
"name": "pyridoxal 5'-phosphate salvage",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e7af8f629dfa33164d7028543f1d1bb94c05e668",
"counters": {
"domain_architectures": 40703,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 40703
}
}
}