HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A411PM25",
"id": "A0A411PM25_9GAMM",
"source_organism": {
"taxId": "2520507",
"scientificName": "Shewanella maritima",
"fullName": "Shewanella maritima"
},
"name": "Succinylglutamate desuccinylase",
"description": [
"Transforms N(2)-succinylglutamate into succinate and glutamate"
],
"length": 341,
"sequence": "MLQASIKDNDFLAFTLAHPQAIDAPFKVNTNSNVNVEVLDTGVICFTPKDYQKDIVLSCAVHGNETAPIEICNELITGLLTGELTLKQRVLFLIGNPPSIHNKTRFVEENMNRLFSGGHANGDTQNQERVRAKALEGYVRDFFEQNDDKQRIHYDLHTAIKPSKHEKFAIYPYRHGKSYSGEQMMFLAACGVDTILYHHEPTTTFSYYSSNEFGADAFTVELGKVMPFGQNDMSKFAKAKAMLTALVTQTEVELPAYEAEQLNLYKVSRSVNKHFEDFTFSFADSTENFTQFNKGEVLATEGGQQVIIEHDIEAIVFPNAKVPVGQRTVLCLIPAPNEDVQ",
"proteome": "UP000291106",
"gene": "astE",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009017",
"name": "succinylglutamate desuccinylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019544",
"name": "L-arginine catabolic process to L-glutamate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019545",
"name": "L-arginine catabolic process to succinate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016788",
"name": "hydrolase activity, acting on ester bonds",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b4d280380897cbd59ff40da1da8545ff27d11c17",
"counters": {
"domain_architectures": 6274,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6274
}
}
}