GET /api/protein/UniProt/A0A401U501/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A401U501",
"id": "A0A401U501_9BACT",
"source_organism": {
"taxId": "2482724",
"scientificName": "Chryseotalea sanaruensis",
"fullName": "Chryseotalea sanaruensis"
},
"name": "Methionine synthase",
"description": [
"Catalyzes the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate"
],
"length": 339,
"sequence": "MSQKIQDILKERILILDGAMGTMIQRHKLEEADFRGEILRDHPHPLKGNNDLLSLTQPDIIKDIHRQYFEAGADIVETNTFGSTSVAQADYHLEHLVYQINYESAKIAKEVANEFTQKEPNKPRFVAGSMGPTTKLASMSPDVNNPGYRAITFDQLVVAFKEQAKALIDGGVDMLLLETVTDTLNVKAGLFAIQELFEETGKEVPVMVSGTITDASGRILSGQTAEAFLISVSHVPLLSVGLNCALGASALRPYLKVLSDRAPFFISAHPNAGLPNEFGQYDQTAVQMGKEVEDYLKEGLINILGGCCGSTPEHIKRIADIAKNYKPRTIDTIEAATTA",
"proteome": "UP000288227",
"gene": "SanaruYs_02130",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1ae0d86dab7df8913f5a23e084cbdedc16cf343f",
"counters": {
"domain_architectures": 21149,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21149
}
}
}