HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3V9E7T3",
"id": "A0A3V9E7T3_SALET",
"source_organism": {
"taxId": "179997",
"scientificName": "Salmonella enterica subsp. enterica serovar Havana",
"fullName": "Salmonella enterica subsp. enterica serovar Havana"
},
"name": "Cobalt-precorrin-2 C(20)-methyltransferase",
"description": [
"Methylates cobalt-precorrin-2 at the C-20 position to produce cobalt-precorrin-3A in the anaerobic cobalamin biosynthesis pathway"
],
"length": 237,
"sequence": "MNGKLYALSTGPGAPDLITVRAARILGSLDILYAPAGRKGGDSLALSIVRDYLGEQTEVRCCHFPMSADGAEKEAVWNEVAAALTAEVEAGKQVGFITLGDAMLFSTWIFLLQRIGCPEWLEIVPGVTSFAAIAARAKMPLAIERQSLAVISCTAPEAEIAQALQQHDSLVLMKVYGRFARIKALLAQAGLLECALMMSEATLPGEQCWRHLHEVNDDRPLPYFSTILVNKQWEYAE",
"proteome": null,
"gene": "GBS55_18640",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030788",
"name": "precorrin-2 C20-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c6fc4066a6a3d3c96c9a871fe22501df278bed0f",
"counters": {
"domain_architectures": 80154,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 2,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 80154
}
}
}