GET /api/protein/UniProt/A0A3V9E7T3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3V9E7T3",
        "id": "A0A3V9E7T3_SALET",
        "source_organism": {
            "taxId": "179997",
            "scientificName": "Salmonella enterica subsp. enterica serovar Havana",
            "fullName": "Salmonella enterica subsp. enterica serovar Havana"
        },
        "name": "Cobalt-precorrin-2 C(20)-methyltransferase",
        "description": [
            "Methylates cobalt-precorrin-2 at the C-20 position to produce cobalt-precorrin-3A in the anaerobic cobalamin biosynthesis pathway"
        ],
        "length": 237,
        "sequence": "MNGKLYALSTGPGAPDLITVRAARILGSLDILYAPAGRKGGDSLALSIVRDYLGEQTEVRCCHFPMSADGAEKEAVWNEVAAALTAEVEAGKQVGFITLGDAMLFSTWIFLLQRIGCPEWLEIVPGVTSFAAIAARAKMPLAIERQSLAVISCTAPEAEIAQALQQHDSLVLMKVYGRFARIKALLAQAGLLECALMMSEATLPGEQCWRHLHEVNDDRPLPYFSTILVNKQWEYAE",
        "proteome": null,
        "gene": "GBS55_18640",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008757",
                "name": "S-adenosylmethionine-dependent methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030788",
                "name": "precorrin-2 C20-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c6fc4066a6a3d3c96c9a871fe22501df278bed0f",
        "counters": {
            "domain_architectures": 80154,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 80154
        }
    }
}