General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3U8WX30",
        "id": "A0A3U8WX30_SALET",
        "source_organism": {
            "taxId": "59201",
            "scientificName": "Salmonella enterica I",
            "fullName": "Salmonella enterica I"
        },
        "name": "23S rRNA (uracil(747)-C(5))-methyltransferase RlmC",
        "description": [
            "Catalyzes the formation of 5-methyl-uridine at position 747 (m5U747) in 23S rRNA"
        ],
        "length": 376,
        "sequence": "MQCALYDAGRCRSCQWITQSVNEQLSAKTADLHRLLAGLPVEQWCAPIGGPEQHFRNKAKMVVSGSVEKPLFGMLYRDGTPVDLCGCPLYPASFDPVFSALKPFIARAGLTPYNVARKRGELKYLLLTESQFDGGMMLRFVLRSETKLTQLRAALPWLRAQLPQLRVITANIQPVHMAIMEGETEIYLTDQQALAERFNDVPLWIRPQSFFQTNPTVASRLYATARDWVGQLPVRHMWDLFCGVGGFGLHCATPQMQLTGIEIAPEAIACAKQSAAELGLTRLHFQALDSTQFATAQGETPDLVLVNPPRRGIGKPLCDYLAQMAPRFIIYSSCNAQTMAQDIRHLPNYRIQRVQLFDMFPHTAHYEVLALLRRSI",
        "proteome": null,
        "gene": "rlmC",
        "go_terms": [
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016436",
                "name": "rRNA (uridine) methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016070",
                "name": "RNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f072bda7cb7a213bdd54e0bf69713d712f60d8a9",
        "counters": {
            "domain_architectures": 19680,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19680
        }
    }
}