HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3T2UVU8",
"id": "A0A3T2UVU8_SHIFL",
"source_organism": {
"taxId": "623",
"scientificName": "Shigella flexneri",
"fullName": "Shigella flexneri"
},
"name": "Chromosome partition protein MukF",
"description": [
"Involved in chromosome condensation, segregation and cell cycle progression. May participate in facilitating chromosome segregation by condensation DNA from both sides of a centrally located replisome during cell division. Not required for mini-F plasmid partitioning. Probably acts via its interaction with MukB and MukE. Overexpression results in anucleate cells. It has a calcium binding activity"
],
"length": 440,
"sequence": "MSEFSQTVPELVAWARKNDFSISLQVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPEDLEYEEFNEIREQLAAIIEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLPAKWQPINDYGAKVQAHVIDKY",
"proteome": null,
"gene": "mukF",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007059",
"name": "chromosome segregation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b76f6bbbd3602e691a174593b73e50174f5a5788",
"counters": {
"domain_architectures": 1796,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"ssf": 2,
"cdd": 2,
"cathgene3d": 3,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1796
}
}
}