General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3S9MUG3",
        "id": "A0A3S9MUG3_9FLAO",
        "source_organism": {
            "taxId": "2496866",
            "scientificName": "Nonlabens ponticola",
            "fullName": "Nonlabens ponticola"
        },
        "name": "Na(+)-translocating NADH-quinone reductase subunit E",
        "description": [
            "NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol"
        ],
        "length": 205,
        "sequence": "MDLINLAVRSIFIENMVFAYFLGMCSYLAVSKSVKTAVGLGAAVVFVLGITVPINWLLDTYLLKPGALSLWLGEEYASIDLSFLSFIMFIAVIASMVQLVEMIVERFAPALYGALGIFLPLIAVNCAILGGSLFMQQKDFSGIDEAAVYGIGSGFGFFLAILAIAAIREKITYSNVPAPLRGLGITFIITGLMALGFMSFMGIEI",
        "proteome": "UP000279600",
        "gene": "nqrE",
        "go_terms": [
            {
                "identifier": "GO:0016655",
                "name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009276",
                "name": "Gram-negative-bacterium-type cell wall",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ab97e895e3c90b2580dc69b86b41d64f6f9b8e90",
        "counters": {
            "domain_architectures": 22630,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22630
        }
    }
}