GET /api/protein/UniProt/A0A3Q9KR39/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q9KR39",
"id": "A0A3Q9KR39_STRGD",
"source_organism": {
"taxId": "45398",
"scientificName": "Streptomyces griseoviridis",
"fullName": "Streptomyces griseoviridis"
},
"name": "Succinate--CoA ligase [ADP-forming] subunit alpha",
"description": [
"Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit"
],
"length": 299,
"sequence": "MAIYLTEKSKILVQGMTGAEGMRHTRRMLAAGTDVVGGVNPRKAGRTVDVDGRALPVFGTVREGIDATGADVTVVFVPPAFAGAAVMEAADAGIGLAVVITEGVPIHDAVAFHAHARSRGTRVIGPNCPGLITPGRSNAGIIPADITKPGRIGLVSKSGTLTYQLMHELRDVGFSTCVGIGGDPVVGTTHIDCLTAFQDDPDTELIVLIGEIGGDAEERAAAHIRDHVTKPVVAYIAGFTAPEGRTMGHAGAIVSGSSGTARAKKEALEAAGVRVGQTPTETAGLVLAHLEGGMRTAIV",
"proteome": "UP000501753",
"gene": "sucD",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "df42c0f55114d0e66044e7b8f2abec5437670277",
"counters": {
"domain_architectures": 26390,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"smart": 1,
"pfam": 2,
"pirsf": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prosite": 2,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26390
}
}
}