GET /api/protein/UniProt/A0A3Q9KR39/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q9KR39",
        "id": "A0A3Q9KR39_STRGD",
        "source_organism": {
            "taxId": "45398",
            "scientificName": "Streptomyces griseoviridis",
            "fullName": "Streptomyces griseoviridis"
        },
        "name": "Succinate--CoA ligase [ADP-forming] subunit alpha",
        "description": [
            "Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit"
        ],
        "length": 299,
        "sequence": "MAIYLTEKSKILVQGMTGAEGMRHTRRMLAAGTDVVGGVNPRKAGRTVDVDGRALPVFGTVREGIDATGADVTVVFVPPAFAGAAVMEAADAGIGLAVVITEGVPIHDAVAFHAHARSRGTRVIGPNCPGLITPGRSNAGIIPADITKPGRIGLVSKSGTLTYQLMHELRDVGFSTCVGIGGDPVVGTTHIDCLTAFQDDPDTELIVLIGEIGGDAEERAAAHIRDHVTKPVVAYIAGFTAPEGRTMGHAGAIVSGSSGTARAKKEALEAAGVRVGQTPTETAGLVLAHLEGGMRTAIV",
        "proteome": "UP000501753",
        "gene": "sucD",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df42c0f55114d0e66044e7b8f2abec5437670277",
        "counters": {
            "domain_architectures": 26390,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 1,
                "pfam": 2,
                "pirsf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26390
        }
    }
}