GET /api/protein/UniProt/A0A3Q7TPB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q7TPB9",
"id": "A0A3Q7TPB9_VULVU",
"source_organism": {
"taxId": "9627",
"scientificName": "Vulpes vulpes",
"fullName": "Vulpes vulpes (Red fox)"
},
"name": "Embryonal stem cell-specific gene 1 protein",
"description": [
"Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs"
],
"length": 116,
"sequence": "MGTLPGRKDIPPWVKVPEDLKDPEVLQVQTQLLEAMFGPAGSRIPYIEQVSKVMLELKVLESSGLTEVLVYGSYLYKLRAKWMLQSMAEWHRQRRERGMLKLEDAMKALQLGPWMK",
"proteome": "UP001652641",
"gene": "LOC112926355",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3471e2e82f0e67356f285e0dac2cbdb8ce7352e7",
"counters": {
"domain_architectures": 872,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 872
}
}
}