GET /api/protein/UniProt/A0A3Q7TPB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q7TPB9",
        "id": "A0A3Q7TPB9_VULVU",
        "source_organism": {
            "taxId": "9627",
            "scientificName": "Vulpes vulpes",
            "fullName": "Vulpes vulpes (Red fox)"
        },
        "name": "Embryonal stem cell-specific gene 1 protein",
        "description": [
            "Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs"
        ],
        "length": 116,
        "sequence": "MGTLPGRKDIPPWVKVPEDLKDPEVLQVQTQLLEAMFGPAGSRIPYIEQVSKVMLELKVLESSGLTEVLVYGSYLYKLRAKWMLQSMAEWHRQRRERGMLKLEDAMKALQLGPWMK",
        "proteome": "UP001652641",
        "gene": "LOC112926355",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3471e2e82f0e67356f285e0dac2cbdb8ce7352e7",
        "counters": {
            "domain_architectures": 872,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 872
        }
    }
}