HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q7RN74",
"id": "A0A3Q7RN74_VULVU",
"source_organism": {
"taxId": "9627",
"scientificName": "Vulpes vulpes",
"fullName": "Vulpes vulpes (Red fox)"
},
"name": "Nuclear transcription factor Y subunit",
"description": [
"Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes"
],
"length": 347,
"sequence": "MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS",
"proteome": "UP001652641",
"gene": "NFYA",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016602",
"name": "CCAAT-binding factor complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "feee120dd0661f6858ad62b5391d846282767cc4",
"counters": {
"domain_architectures": 10471,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"smart": 1,
"profile": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10471
}
}
}