General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q7NCX5",
        "id": "A0A3Q7NCX5_CALUR",
        "source_organism": {
            "taxId": "34884",
            "scientificName": "Callorhinus ursinus",
            "fullName": "Callorhinus ursinus (Northern fur seal)"
        },
        "name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2",
        "description": [
            "Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor"
        ],
        "length": 279,
        "sequence": "MPMYQEESDPSLQALESRQDDILKRLYELKAAVDGLSKMIHTPDADVDVTNIIQADEPTFSTSALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCDHYRVLSTVHTHSAVKSVPEHLLKCFGEQSKKQPRHEYQLGFTLIWKNVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKQDAVTLTLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLVGNELTVADVVLWSVLQQAGGCGGTVPANVQKWMRACENLAPFNTALKLLK",
        "proteome": "UP000286641",
        "gene": "AIMP2",
        "go_terms": [
            {
                "identifier": "GO:0017101",
                "name": "aminoacyl-tRNA synthetase multienzyme complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "348b92916523d2e6ed6a105fa2c04ae31f35a0a0",
        "counters": {
            "domain_architectures": 297,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 297
        }
    }
}