General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q7MFM5",
        "id": "A0A3Q7MFM5_CALUR",
        "source_organism": {
            "taxId": "34884",
            "scientificName": "Callorhinus ursinus",
            "fullName": "Callorhinus ursinus (Northern fur seal)"
        },
        "name": "Neuronal PAS domain-containing protein 1",
        "description": [
            "May control regulatory pathways relevant to schizophrenia and to psychotic illness. May play a role in late central nervous system development by modulating EPO expression in response to cellular oxygen level. Forms a heterodimer that binds core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) leading to transcriptional repression on its target gene TH"
        ],
        "length": 593,
        "sequence": "MAAPYPSSGGGGEVKCGGGRGRSVPWDFLPGLVVKAPPGPCLQAQRKEKSRNAARSRRGKENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLAPGHRGPVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYIHPGDHSEVLEQLGLRAPTPGPPTPPSVPSSSSSSSSSSLADTPEIEASAAEVPPFSRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARSLGLVALGHTLPPAPLAELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDAARIRQSHLDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLSQAEGGQTPLDAFQLPASVACEDASSPEPEPTEPEPPVEGKQAAPLDKDEAPRSRGKRIKVEPLPGDAKDPEDSGDEEPSGHPALPRPEFTSVIRAGALKQDLVRPWGLGPPGDPPPSLLHAGFLPPVVRGLCTPGTIRYGPAELGLMYPHLQRLGPGPTLPEAFYPPLGLPYPGPTGTRVQRKGD",
        "proteome": "UP000286641",
        "gene": "NPAS1",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4f46862b61479e043e7dda534509ff0ecb262b1",
        "counters": {
            "domain_architectures": 2626,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 2,
                "profile": 2,
                "pfam": 3,
                "smart": 2,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2626
        }
    }
}