General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q3LH96",
        "id": "A0A3Q3LH96_9TELE",
        "source_organism": {
            "taxId": "205130",
            "scientificName": "Mastacembelus armatus",
            "fullName": "Mastacembelus armatus (zig-zag eel)"
        },
        "name": "Gamma-interferon-inducible lysosomal thiol reductase",
        "description": [
            "Lysosomal thiol reductase that can reduce protein disulfide bonds. Facilitates the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing"
        ],
        "length": 245,
        "sequence": "MKLSGLLAVFFFLCTDRTGFGTFHLKPACHYPPSQWCRSLEIAIECKVQKQCMEVNATRLNQAVSPVSVTLYYESLCPACSLHLPDIMTVTLVPYGNAKLLSANSPFTCQHGEPECRGNMIEACIIHLSGHSAFHIIYCMESAADVLNAAEPCLQLYAPSVSWSSVDSCVKGGLGYQLMHANAVITRALNPAHTHIPWVTFNGKYKEENEDKAMSSLPHLVCHLYKGVKPPACTGASVRLDRNIC",
        "proteome": "UP000261640",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0016671",
                "name": "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f0b88ab819c587f0eadd0cd43a7aa28f82912e30",
        "counters": {
            "domain_architectures": 453,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "panther": 1,
                "pfam": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 453
        }
    }
}