General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q3FU43",
        "id": "A0A3Q3FU43_9LABR",
        "source_organism": {
            "taxId": "56723",
            "scientificName": "Labrus bergylta",
            "fullName": "Labrus bergylta (ballan wrasse)"
        },
        "name": "Chromatin modification-related protein MEAF6",
        "description": [
            "Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity"
        ],
        "length": 215,
        "sequence": "MAMHAKATPPQIPDTRRELAELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAVCALGGIPDHMNEKREAGSGTESDASPDLQNQENEPSQEDTEDVDSTLQDLKPQKAASSSSSGSHHGSHKKRKNKNRHSPSLLCCRFDMKVNKKPRAVSQNHFLFFKVLKEECVTF",
        "proteome": "UP000261660",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0000123",
                "name": "histone acetyltransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ea58ca9b12f062ad647d544945a543df359f073c",
        "counters": {
            "domain_architectures": 4751,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4751
        }
    }
}